APOL2

 Apolipoprotein L2 is a protein that in humans is encoded by the APOL2 gene.^[5][6][7]

APOL2
Identifiers
Aliases	APOL2, APOL-II, APOL3, apolipoprotein L2
External IDs	OMIM: 607252 MGI: 2444921 HomoloGene: 12785 GeneCards: APOL2
Gene location (Human) Chr. Chromosome 22 (human)[1] Band 22q12.3 Start 36,226,209 bp[1] End 36,239,954 bp[1]
Gene location (Mouse) Chr. Chromosome 15 (mouse)[2] Band 15|15 E1 Start 77,747,798 bp[2] End 77,757,003 bp[2]
RNA expression pattern More reference expression data
Gene ontology Molecular function • receptor binding • lipid binding • high-density lipoprotein particle binding Cellular component • cytoplasm • extracellular region • endoplasmic reticulum membrane • membrane Biological process • multicellular organism development • lipoprotein metabolic process • lipid transport • cholesterol metabolic process • acute-phase response • maternal process involved in female pregnancy • lipid metabolism • transport Sources:Amigo / QuickGO
Orthologs
Species	Human	Mouse
Entrez	23780	239552
Ensembl	ENSG00000128335	ENSMUSG00000056656
UniProt	Q9BQE5	n/a
RefSeq (mRNA)	NM_030882 NM_145637	NM_001081970 NM_001357895 NM_001357896
RefSeq (protein)	NP_112092 NP_663612	n/a
Location (UCSC)	Chr 22: 36.23 – 36.24 Mb	Chr 15: 77.75 – 77.76 Mb
PubMed search	[3]	[4]
Wikidata
View/Edit Human View/Edit Mouse

This gene is a member of the apolipoprotein L gene family and protein in this family are lipid-binding proteins. This gene encodes a 37.1 kDa protein and The protein sequence contains 337bp. Localization of this protein is mainly found in the cytosol, nucleoplasm and additionally, it is also seen in the Nuclear bodies.^[8] The involvement of this gene may affect in the movement of lipids and binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene.^[7]

Protein SequenceEdit

Learn more This section does not cite any sources.

>sp|Q9BQE5|1-337

MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLA

SHMVMKDKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVS

NSVGTTSGILTLLGLGLAPFTEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQ

ARNLDQSGTNVAKVMKEFVGGNTPNVLTLVDNWYQVTQGIGRNIRAIRRARANPQLGAYA

PPPHIIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATGGILLLLDVVSLAYESKHLLE

GAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ

InteractionsEdit

APOL2 has been shown to interact with:

• IFN-γ,^[9]

• CD81,^[10]

• TNF-α,^[11]

• Bcl-2,^[12]

Splice VariantsEdit

ApoL2 has 5 splice variants,^[13]

• APOL2-001

This transcript has got 6 exons, 12 domains and features are annotated, 263 variations are related this and maps to 35 oligo probes.

• APOL2-002

This transcript has got 5 exons, 12 domains and features are annotated, 263 variations are related with this gene and maps to 37 oligo probes.

• APOL2-006

This transcript has got 6 exons, is annotated with 3 domains and features, 62 variations are related with this gene and maps to 20 oligo probes.

• APOL2-008

This transcript has got 6 exons, 12 domains and features are annotated, 331 variations are related with this gene and maps to 32 oligo probes.

• APOL2-009

This transcript has got 5 exons, 4 domains and features are annotated, 104 variations are related with this gene and maps to 13 oligo probes.

Functions of the ApoL2Edit

• Acute Inflammation Response ^[14][15]
• Cholesterol Metabolic Process^[16]
• Lipid Metabolic Process^[12]
• Maternal Process Involved in Female Pregnancy^[17]
• Lipid binding^[18]
• Signalling Receptor Binding^[18]

This article uses material from the Wikipedia article  Metasyntactic variable, which is released under the  Creative Commons Attribution-ShareAlike 3.0 Unported License.